PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_21.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25384 Da    PI: 8.7368
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_21.11genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.72.8e-271059251
                                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                 +ien + rqvtfskRr g++KKA ELSvLCda+va+i+fs tgkl++y+s
  evm.model.supercontig_21.11 10 KIENVTARQVTFSKRRRGLFKKADELSVLCDADVALIVFSATGKLFDYCS 59
                                 69**********************************************96 PP

2K-box46.51.6e-16951732199
                        K-box  21 lakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                                    +L kei    +++R+++GedL+ L+++ LqqLe+ Le +l ++ + K+e ++++i+ l +k  +l een++L++k+ 
  evm.model.supercontig_21.11  95 RIRLSKEIADKSHQLRQMKGEDLQGLNVEKLQQLEKMLEAGLGRVVQMKSEKITSEISALERKGAQLMEENQKLKEKMR 173
                                  55788888888999**************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.408161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-37160IPR002100Transcription factor, MADS-box
CDDcd002652.17E-37277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-30377IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003199.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.06888178IPR002487Transcription factor, K-box
PfamPF014865.8E-1692172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MAREKIRIRK IENVTARQVT FSKRRRGLFK KADELSVLCD ADVALIVFSA TGKLFDYCSS  60
RSSMKDMLSR YNMHSNNVNK LEPPPLELQI ENNNRIRLSK EIADKSHQLR QMKGEDLQGL  120
NVEKLQQLEK MLEAGLGRVV QMKSEKITSE ISALERKGAQ LMEENQKLKE KMREICKGKK  180
GGVLETDVGL HEEGLSSESV NNTNACSCSS GPPPEDDSSD TSLRLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S6e-16175173Myocyte-specific enhancer factor 2B
1tqe_R6e-16175173Myocyte-specific enhancer factor 2B
1tqe_Q6e-16175173Myocyte-specific enhancer factor 2B
1tqe_P6e-16175173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018219.11e-117K-box region and MADS-box transcription factor family protein
SwissprotQ9FVC19e-93SVP_ARATH; MADS-box protein SVP
TrEMBLA0A061FLR31e-117A0A061FLR3_THECC; K-box region and MADS-box transcription factor family protein
STRINGVIT_18s0001g07460.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Representative plantOGRP60761120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-86MIKC_MADS family protein